missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Cdc27 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
369.00 € - 593.00 €
Specifications
| Antigen | Cdc27 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18262075
|
Novus Biologicals
NBP2-56172 |
100 μL |
593.00 €
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18648847
|
Novus Biologicals
NBP2-56172-25ul |
25 μL |
369.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Cdc27 Polyclonal specifically detects Cdc27 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| Cdc27 | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 996 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:AIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRLLKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVFNKQKS | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| ANAPC3CDC27 homolog, anaphase promoting complex subunit 3, Anaphase-promoting complex subunit 3, anaphase-promoting complex, protein 3, APC 3, APC3cell division cycle 27, CDC27Hs, cell division cycle 27 homolog (S. cerevisiae), cell division cycle protein 27 homolog, D0S1430E, D17S978E, HNUC, H-NUC, NUC2, nuc2 homolog | |
| CDC27 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title