missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CDHR4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-62703
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
CDHR4 Polyclonal antibody specifically detects CDHR4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Especificaciones
| CDHR4 | |
| Polyclonal | |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| cadherin-like 29, cadherin-like protein 29, Cadherin-like protein UNQ9392/PRO34300, cadherin-related family member 4, CDH29, MGC164982, PRO34300 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: ATLDYKLWFRSSSNPASLCLYDRVLEVNATLDCDTPGACFQHAASILVLDGGQPQMTTEVPVLVMVTPINEFSPACAPRTFRVQE | |
| 100 μg | |
| Primary | |
| Human | |
| Purified |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| 389118 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido