missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CDK8 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-92972-0.1ml
This item is not returnable.
View return policy
Description
CDK8 Polyclonal antibody specifically detects CDK8 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunoprecipitation, Gene Knock-Out
Specifications
| CDK8 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, Immunoprecipitation 1:50 - 1:100, Knockout Validated | |
| CDK8 protein kinase, Cell division protein kinase 8, cyclin-dependent kinase 8, EC 2.7.11, EC 2.7.11.22, EC 2.7.11.23, K35, Mediator complex subunit CDK8, Mediator of RNA polymerase II transcription subunit CDK8, MGC126074, MGC126075, Protein kinase K35 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 365-464 of human CDK8 (NP_001251.1). DDKGDKKNQQQQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY | |
| 0.1 mL | |
| Cell Cycle and Replication | |
| 1024 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunoprecipitation, Gene Knock-Out | |
| Unconjugated | |
| PBS, 50% glycerol, pH 7.3 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction