missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CENPI Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-56199-25ul
This item is not returnable.
View return policy
Description
CENPI Polyclonal specifically detects CENPI in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
| CENPI | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL | |
| CENP-IFSH primary response (LRPR1, rat) homolog 1, centromere protein I, Follicle-stimulating hormone primary response protein, FSH primary response 1, FSH primary response protein 1, FSHPRH1Mis6, ICEN19, Interphase centromere complex protein 19, Leucine-rich primary response protein 1, LRPR1FSH primary response (LRPR1 homolog, rat) 1, Mis6 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 2491 | |
| Human | |
| IgG |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| CENPI | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PRNSKNISKHGQNNPVGDYEHADDQAEEDALQMAVGYFEKGPIKASQNKDKTLEKHLKTVENVAWKNGLASEEIDILLNIALSGKFGNAVN | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction