missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CEP89 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
572.00 €
Specifications
| Antigen | CEP89 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18600276
|
Novus Biologicals
NBP2-38446-25ul |
25 μL |
N/A
|
N/A | |||||
|
18170189
|
Novus Biologicals
NBP2-38446 |
0.1 mL |
572.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CEP89 Polyclonal specifically detects CEP89 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| CEP89 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q96ST8 | |
| 84902 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: QVLKDKQEVLDQALQQNREMEGELEVIWESTFRENRRIRELLQDTLTRTGVQDNPRALVAPSLNGVSQADLLDGCDVCSYD | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| CCDC123, centrosomal protein 89kDa, centrosomal protein of 89 kDa, coiled-coil domain containing 123, coiled-coil domain-containing protein 123, mitochondrial, FLJ14640 | |
| CEP89 | |
| IgG | |
| Affinity Purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title