missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Chymase/CMA1/Mast Cell Chymase Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
Brand: Novus Biologicals NBP2-33660-25ul
305.15 EUR valid until 2025-12-16
BEST PRICE on Promo! Use promo code "24090" to get your promotional price.
This item is not returnable.
View return policy
Description
Chymase/CMA1/Mast Cell Chymase Polyclonal specifically detects Chymase/CMA1/Mast Cell Chymase in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| Chymase/CMA1/Mast Cell Chymase | |
| Polyclonal | |
| Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| P23946 | |
| CMA1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: GRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDS | |
| 25 μL | |
| Cell Biology, Cytoskeleton Markers, Immunology, Innate Immunity, Mast Cell Markers | |
| 1215 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| Alpha-chymase, chymase, chymase 1 preproprotein transcript E, chymase 1 preproprotein transcript I, chymase 1, mast cell, chymase, heart, chymase, mast cell, CYH, CYM, EC 3.4.21, EC 3.4.21.39, Mast cell protease I, MCT1, MGC119890, MGC119891 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto