missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CIITA Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-91543
This item is not returnable.
View return policy
Description
CIITA Polyclonal specifically detects CIITA in Mouse samples. It is validated for Western Blot.
Specifications
| CIITA | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| C2TA, C2TAMHC class II transactivator type III, CIITAIV, class II, major histocompatibility complex, transactivator, MHC class II transactivator, MHC2TANLR family, acid domain containing, NLRA, nucleotide-binding oligomerization domain, leucine rich repeat and acid domaincontaining | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 4261 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| NP_031601 | |
| CIITA | |
| Synthetic peptide directed towards the C terminal of mouse C2TA. Peptide sequence MALWESLQQQGEAQLLQAAEEKFTIEPFKAKSPKDVEDLDRLVQTQRLRN. | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Mouse: 100%. | |
| Human, Mouse, Rat, Canine | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction