missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CISD2 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-92736-0.02ml
This item is not returnable.
View return policy
Description
CISD2 Polyclonal antibody specifically detects CISD2 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| CISD2 | |
| Polyclonal | |
| Western Blot 1:500-1:2000, Immunohistochemistry 1:100-1:200, Immunohistochemistry-Paraffin | |
| CDGSH iron sulfur domain 2, CDGSH iron-sulfur domain-containing protein 2, CDGSH2, Endoplasmic reticulum intermembrane small protein, ERISWFS2, Miner1Wolfram syndrome 2, mitoNEET related 1, MitoNEET-related 1 protein, NAF-1, Nutrient-deprivation autophagy factor-1, ZCD2CDGSH iron sulfur domain-containing protein 2, zinc finger, CDGSH-type domain 2 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 61-135 of human CISD2 (NP_001008389.1). PKKKQQKDSLINLKIQKENPKVVNEINIEDLCLTKAAYCRCWRSKTFPACDGSHNKHNELTGDNVGPLILKKKEV | |
| 0.02 mL | |
| Neuroscience, Signal Transduction | |
| 493856 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto