missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CISD2 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
190.00 € - 463.00 €
Specifications
| Antigen | CISD2 |
|---|---|
| Dilution | Western Blot 1:500-1:2000, Immunohistochemistry 1:100-1:200, Immunohistochemistry-Paraffin |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18610882
|
Novus Biologicals
NBP2-92786-0.02ml |
0.02 mL |
190.00 €
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18610252
|
Novus Biologicals
NBP2-92786-0.1ml |
0.1 mL |
463.00 €
0.01mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CISD2 Polyclonal antibody specifically detects CISD2 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| CISD2 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Neuroscience, Signal Transduction | |
| PBS with 50% glycerol, pH7.3. | |
| 493856 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000, Immunohistochemistry 1:100-1:200, Immunohistochemistry-Paraffin | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| CDGSH iron sulfur domain 2, CDGSH iron-sulfur domain-containing protein 2, CDGSH2, Endoplasmic reticulum intermembrane small protein, ERISWFS2, Miner1Wolfram syndrome 2, mitoNEET related 1, MitoNEET-related 1 protein, NAF-1, Nutrient-deprivation autophagy factor-1, ZCD2CDGSH iron sulfur domain-containing protein 2, zinc finger, CDGSH-type domain 2 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 61-135 of human CISD2 (NP_001008389.1). PKKKQQKDSLINLKIQKENPKVVNEINIEDLCLTKAAYCRCWRSKTFPACDGSHNKHNELTGDNVGPLILKKKEV | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title