missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Clathrin Heavy Chain 2/CHC22/CLTCL1 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-92400-0.02ml
This item is not returnable.
View return policy
Description
Clathrin Heavy Chain 2/CHC22/CLTCL1 Polyclonal antibody specifically detects Clathrin Heavy Chain 2/CHC22/CLTCL1 in Human samples. It is validated for Western Blot
Specifications
| Clathrin Heavy Chain 2/CHC22/CLTCL1 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| CHC22, clathrin heavy chain 2, clathrin heavy chain on chromosome 22, clathrin, heavy chain-like 1, Clathrin, heavy polypeptide D, CLTCL, heavy polypeptide-like 1 | |
| A synthetic peptide corresponding to a sequence within amino acids 1600-1663 of human Clathrin Heavy Chain 2/CHC22/CLTCL1 (NP_009029.3). IQVMREYLSKVDKLDALESLRKQEEHVTEPAPLVFDFDGHE | |
| 0.02 mL | |
| B Cell Development and Differentiation Markers, Immunology, Neurodegeneration, Neuroscience | |
| 8218 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction