missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CMTM4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
292.00 € - 572.00 €
Specifications
| Antigen | CMTM4 |
|---|---|
| Dilution | Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18427600
|
Novus Biologicals
NBP1-84457-25ul |
25 μL |
292.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18760054
|
Novus Biologicals
NBP1-84457 |
572.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||||
Description
CMTM4 Polyclonal specifically detects CMTM4 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| CMTM4 | |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| chemokine-like factor super family 4, chemokine-like factor superfamily 4, Chemokine-like factor superfamily member 4, CKLF-like MARVEL transmembrane domain containing 4, CKLF-like MARVEL transmembrane domain-containing protein 4, CKLFSF4 | |
| CMTM4 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Cytokine Research | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 146223 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:KWRVSVRQQSTNDYIRARTESRDVDSRPEIQRLDTFSYSTNVTVRKKSPTNLLSLNHWQ | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title