missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CMTM5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
415.00 € - 624.00 €
Specifications
| Antigen | CMTM5 |
|---|---|
| Applications | Western Blot, Flow Cytometry, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18157467
|
Novus Biologicals
NBP2-47503 |
0.1 mL |
624.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18633186
|
Novus Biologicals
NBP2-47503-25ul |
25 μL |
415.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CMTM5 Polyclonal specifically detects CMTM5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| CMTM5 | |
| Polyclonal | |
| Rabbit | |
| Cytokine Research | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 116173 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: MLSARDRRDRHPEEGVVAELQGFAVDKAFLTSHKGI | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Flow Cytometry, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| chemokine-like factor super family 5, chemokine-like factor superfamily 5, Chemokine-like factor superfamily member 5, CKLF-like MARVEL transmembrane domain containing 5, CKLF-like MARVEL transmembrane domain-containing protein 5, CKLFSF5, FLJ37521 | |
| CMTM5 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title