missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CMTM6 Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
213.00 € - 507.00 €
Specifications
| Antigen | CMTM6 |
|---|---|
| Dilution | Western Blot 1:2000 - 1:20000, ELISA Recommended starting concentration is 1 μg/mL |
| Applications | ELISA, Western Blot |
| Classification | Monoclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30232552
|
Novus Biologicals
NBP3-33308-20ul |
20 μL |
213.00 €
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30230507
|
Novus Biologicals
NBP3-33308-100ul |
100 μL |
507.00 €
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CMTM6 Monoclonal antibody specifically detects CMTM6 in Human,Rat samples. It is validated for ELISA,Western BlotSpecifications
| CMTM6 | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cytokine Research | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| 54918 | |
| IgG | |
| Affinity purified |
| Western Blot 1:2000 - 1:20000, ELISA Recommended starting concentration is 1 μg/mL | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human, Rat | |
| chemokine-like factor super family 6, chemokine-like factor superfamily 6, Chemokine-like factor superfamily member 6, CKLF-like MARVEL transmembrane domain containing 6, CKLF-like MARVEL transmembrane domain-containing protein 6, CKLFSF6, FLJ20396, PRO2219 | |
| A synthetic peptide corresponding to a sequence within amino acids 84-183 of human CMTM6 (NP_060271.1).,, Sequence:, LILIVYCTPFYERVDTTKVKSSDFYITLGTGCVFLLASIIFVSTHDRTSAEIAAIVFGFIASFMFLLDFITMLYEKRQESQLRKPENTTRAEALTEPLNA | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title