missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CNOT2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
280.00 € - 605.00 €
Specifications
| Antigen | CNOT2 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18016604
|
Novus Biologicals
NBP2-56034 |
100 μL |
605.00 €
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18648126
|
Novus Biologicals
NBP2-56034-25ul |
25 μL |
280.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CNOT2 Polyclonal specifically detects CNOT2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin.Specifications
| CNOT2 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| CCR4-associated factor 2, CCR4-NOT transcription complex, subunit 2, CDC36FLJ26456, negative regulator of transcription 2, NOT2CCR4-NOT transcription complex subunit 2, NOT2H | |
| CNOT2 | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 4848 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DGSENVTGLDLSDFPALADRNRREGSGNPTPLINPLAGRAPYVGMVTKPANEQSQDFSIHNEDFPALPGSSYKDPT | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title