missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CNOT7 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-92571-0.02ml
This item is not returnable.
View return policy
Description
CNOT7 Polyclonal antibody specifically detects CNOT7 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| CNOT7 | |
| Polyclonal | |
| Western Blot 1:200-1:2000, Immunohistochemistry 1:50-1:200, Immunohistochemistry-Paraffin | |
| BTG1 binding factor 1, BTG1-binding factor 1, CAF-1, CAF1carbon catabolite repressor protein (CCR4)-associative factor 1, CCR4-associated factor 1, CCR4-NOT transcription complex subunit 7, CCR4-NOT transcription complex, subunit 7, hCAF-1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 90-160 of human CNOT7 (NP_037486.2). PGTSTWQFNFKFNLTEDMYAQDSIELLTTSGIQFKKHEEEGIETQYFAELLMTSGVVLCEGVKWLSFHSGY | |
| 0.02 mL | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 29883 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction