missing translation for 'onlineSavingsMsg'
Learn More
Learn More
COX4NB Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-13864
This item is not returnable.
View return policy
Description
COX4NB Polyclonal specifically detects COX4NB in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| COX4NB | |
| Polyclonal | |
| Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| C16orf2, C16orf4, chromosome 16 open reading frame 2, COX4 neighbor, COX4AL, FAM158Bchromosome 16 open reading frame 4, neighbor of COX4, NOC4family with sequence similarity 158, member B, Protein FAM158B | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| EMC8 | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: VKLTTQAYCKMVLHGAKYPHCAVNGLLVAEKQKPRKEHLPLGGPGAHHTLFVD | |
| 0.1 mL | |
| Core ESC Like Genes, Stem Cell Markers | |
| 10328 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction