missing translation for 'onlineSavingsMsg'
Learn More

CPNE2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Novus Biologicals NBP2-30692-25ul

View more versions of this product

Product Code. 18405192

280.00 € / 25µL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

CPNE2 Polyclonal specifically detects CPNE2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen	CPNE2
Classification	Polyclonal
Dilution	Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Accession No.	Q96FN4
Gene Symbols	CPNE2
Immunogen	This antibody was developed against a recombinant protein corresponding to amino acids: YKPGDDGKWMLVHRTEVIKYTLDPVWKPFTVPLVSLCDGDMEKPIQVMCY
Quantity	25 μL
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Applications	Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias	copine IICPN2, copine-2, COPN2, DKFZp686E06199, MGC16924
Host Species	Rabbit
Purification Method	Affinity Purified
Regulatory Status	RUO
Gene ID (Entrez)	221184
Target Species	Human
Isotype	IgG

Product Suggestions

Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts

Ihr Name

E-Mail Adresse *

Art der Problems *

Detaillierte Beschreibung des Problems/der Anfrage *

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Abbrechen Absenden

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt

For Research Use Only

Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur

CPNE2 Antibody, Novus Biologicals™

Description

Specifications

Product Suggestions

Dokumentation

Aktionen