missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CRHR2/CRF2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
369.00 € - 593.00 €
Spezifikation
| Antigen | CRHR2/CRF2 |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Produktcode | Marke | Quantity | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Quantity | Preis | Menge & Verfügbarkeit | |||||
|
18400592
|
Novus Biologicals
NBP2-13875-25ul |
25ul |
369.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18759603
|
Novus Biologicals
NBP2-13875 |
593.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||||
Beschreibung
CRHR2/CRF2 Polyclonal specifically detects CRHR2/CRF2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Spezifikation
| CRHR2/CRF2 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| corticotropin releasing hormone receptor 2, corticotropin-releasing factor receptor 2, Corticotropin-releasing hormone receptor 2, CRF2, CRF2R, CRFR2, CRF-R2, CRF-R-2, CRFR-2, CRH2R, CRH-R2, CRH-R-2 | |
| CRHR2 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| GPCR, Neuroscience, Neurotransmission | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 1395 | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: PCPEYFNGVKYNTTRNAYRECLENGTWASKINYSQCEPILDDKQRKYDLHYR | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts