missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CRHR2/CRF2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
369.00 € - 593.00 €
Specifications
| Antigen | CRHR2/CRF2 |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18400592
|
Novus Biologicals
NBP2-13875-25ul |
25ul |
369.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18759603
|
Novus Biologicals
NBP2-13875 |
593.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||||
Description
CRHR2/CRF2 Polyclonal specifically detects CRHR2/CRF2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| CRHR2/CRF2 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| corticotropin releasing hormone receptor 2, corticotropin-releasing factor receptor 2, Corticotropin-releasing hormone receptor 2, CRF2, CRF2R, CRFR2, CRF-R2, CRF-R-2, CRFR-2, CRH2R, CRH-R2, CRH-R-2 | |
| CRHR2 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| GPCR, Neuroscience, Neurotransmission | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 1395 | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: PCPEYFNGVKYNTTRNAYRECLENGTWASKINYSQCEPILDDKQRKYDLHYR | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title