missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CRYGB Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
198.00 € - 462.00 €
Specifications
| Antigen | CRYGB |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Beschreibung
CRYGB Polyclonal antibody specifically detects CRYGB in Mouse, Rat samples. It is validated for Western BlotSpezifikation
| CRYGB | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Mouse, Rat | |
| CRYG2gamma-crystallin B, crystallin, gamma 1-2, crystallin, gamma B, gamma-B-crystallin, Gamma-crystallin 1-2 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 80-135 of human CRYGB (NP_005201.2). CLIPPHSGAYRMKIYDRDELRGQMSELTDDCISVQDRFHLTEIHSLNVLEGSWILY | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS with 50% glycerol, pH7.3. | |
| 1419 | |
| IgG | |
| Affinity purified |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts