missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CRYGB Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-92172-0.1ml
This item is not returnable.
View return policy
Description
CRYGB Polyclonal antibody specifically detects CRYGB in Mouse, Rat samples. It is validated for Western Blot
Specifications
| CRYGB | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| CRYG2gamma-crystallin B, crystallin, gamma 1-2, crystallin, gamma B, gamma-B-crystallin, Gamma-crystallin 1-2 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 80-135 of human CRYGB (NP_005201.2). CLIPPHSGAYRMKIYDRDELRGQMSELTDDCISVQDRFHLTEIHSLNVLEGSWILY | |
| 0.1 mL | |
| Primary | |
| Mouse, Rat | |
| Purified |
| Western Blot | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 1419 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction