missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CXCR1/IL-8RA Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
369.00 € - 529.00 €
Specifications
| Antigen | CXCR1/IL-8RA |
|---|---|
| Dilution | Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18622679
|
Novus Biologicals
NBP2-48621-25ul |
25 μL |
369.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18642679
|
Novus Biologicals
NBP2-48621 |
0.1 mL |
529.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CXCR1/IL-8RA Polyclonal antibody specifically detects CXCR1/IL-8RA in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| CXCR1/IL-8RA | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Chemokines and Cytokines, Cytokine Research, GPCR, Immunology, Innate Immunity, Signal Transduction | |
| PBS (pH 7.2), 40% Glycerol | |
| 3577 | |
| IgG | |
| Immunogen affinity purified |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| CD128, CD181, CD181 antigen, CDw128aC-C, chemokine (C-X-C motif) receptor 1, CKR-1, CMKAR1, C-X-C chemokine receptor type 1, CXC-R1, CXCR-1, High affinity interleukin-8 receptor A, IL-8 receptor type 1, IL-8R A, IL8R1, IL8RAC-C-CKR-1, IL8RBA, interleukin 8 receptor, alpha, interleukin-8 receptor type 1, interleukin-8 receptor type A | |
| This antibody was developed against a recombinant protein corresponding to amino acids: MSNITDPQMWDFDDLNFTGMPPADEDYSPCMLETETLNK | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title