missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Cyclophilin A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-46850
This item is not returnable.
View return policy
Description
Cyclophilin A Polyclonal antibody specifically detects Cyclophilin A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| Cyclophilin A | |
| Polyclonal | |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Q9Y536 | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Cyclophilin A, Cyclosporin A-binding protein, CYPAMGC12404, CYPH, EC 5.2.1.8, MGC117158, MGC23397, peptidyl-prolyl cis-trans isomerase A, peptidylprolyl isomerase A (cyclophilin A), PPIase A, Rotamase A, T cell cyclophilin | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: FGKVKERVNIVEAMEHFGYRNSKTSKKITIADCG | |
| 0.1 mL | |
| Cancer, Cell Cycle and Replication, Stem Cell Markers | |
| 5478 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction