missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CYP20A1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-31614
This item is not returnable.
View return policy
Description
CYP20A1 Polyclonal specifically detects CYP20A1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| CYP20A1 | |
| Polyclonal | |
| Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Q6UW02 | |
| CYP20A1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: PGITPTEEKDGNLPDIVNSGSLHEFLVNLHERYGPVVSFWFGRRLVVSLGTVDVLKQHINPNKTLDPFETMLKSL | |
| 0.1 mL | |
| Cancer, Cardiovascular Biology, Cellular Signaling, metabolism | |
| 57404 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| CYP-M, cytochrome P450 20A1, cytochrome P450 monooxygenase, cytochrome P450, family 20, subfamily A, polypeptide 1, EC 1.14, MGC22229 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction