missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Cytokeratin 13 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-68890
This item is not returnable.
View return policy
Description
Cytokeratin 13 Polyclonal antibody specifically detects Cytokeratin 13 in Human samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
Specifications
| Cytokeratin 13 | |
| Polyclonal | |
| Western Blot 0.04-0.4 μg/mL, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL | |
| CK13, CK-13, cytokeratin 13, Cytokeratin-13, K13cytokeratin-13, keratin 13, keratin, type I cytoskeletal 13, keratin-13, MGC161462, MGC3781 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: EGQDAKMIGFPSSAGSVSPRSTSVTTTSSASVTTTSNASGRRTSDVRRP | |
| 100 μg | |
| Cell Biology, Cellular Markers | |
| 3860 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction