missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
280.00 € - 589.00 €
Specifications
| Antigen | Cytosolic Sulfotransferase 2B1/SULT2B1 |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18450612
|
Novus Biologicals
NBP2-33396-25ul |
25 μL |
280.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18196154
|
Novus Biologicals
NBP2-33396 |
0.1 mL |
589.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Cytosolic Sulfotransferase 2B1/SULT2B1 Polyclonal specifically detects Cytosolic Sulfotransferase 2B1/SULT2B1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Cytosolic Sulfotransferase 2B1/SULT2B1 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| O00204 | |
| 6820 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: GLWDTYEDDISEISQKLPGEYFRYKGVPFPVGLYSLESISLAENTQDVRDDDIFIITYPKS | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| metabolism | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| Alcohol sulfotransferase, EC 2.8.2, EC 2.8.2.2, HSST2sulfotransferase family cytosolic 2B member 1, Hydroxysteroid sulfotransferase 2, ST2B1, Sulfotransferase 2B1, sulfotransferase family, cytosolic, 2B, member 1 | |
| SULT2B1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title