missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DDX21 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-38311-25ul
This item is not returnable.
View return policy
Description
DDX21 Polyclonal specifically detects DDX21 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.
Specifications
| DDX21 | |
| Polyclonal | |
| Western Blot 0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Q9NR30 | |
| DDX21 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: DSRRWQLSVATEQPELEGPREGYGGFRGQREGSRGFRGQRDGNRRFRGQREGSRGPRGQRSGGGNKSNRSQNKGQKRSFSKAFGQ | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| DEAD (Asp-Glu-Ala-Asp) box polypeptide 21, DEAD box protein 21, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 21, DKFZp686F21172, EC 3.6.1, EC 3.6.4.13, Gu protein, GUA, gu-alpha, GURDB, nucleolar RNA helicase 2, Nucleolar RNA helicase Gu, Nucleolar RNA helicase II, RH II/Gu, RH-II/GU, RH-II/GuA, RNA helicase II/Gu alpha | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 9188 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction