missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Deoxyguanosine kinase Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-49251-25ul
This item is not returnable.
View return policy
Description
Deoxyguanosine kinase Polyclonal antibody specifically detects Deoxyguanosine kinase in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| Deoxyguanosine kinase | |
| Polyclonal | |
| Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| deoxyguanosine kinase, deoxyguanosine kinase, mitochondrial, DGK, dGKmitochondrial deoxyguanosine kinase, EC 2.7.1.113, MTDPS3 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: EAWLIHKTTKLHFEALMNIPVLVLDVNDDFSEEVTKQEDLMREVNTFVKN | |
| 25 μL | |
| Signal Transduction | |
| 1716 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction