missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DHRS9 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
280.00 € - 572.00 €
Specifications
| Antigen | DHRS9 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18451011
|
Novus Biologicals
NBP1-89379-25ul |
25 μL |
280.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18260488
|
Novus Biologicals
NBP1-89379 |
0.1 mL |
572.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
DHRS9 Polyclonal specifically detects DHRS9 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| DHRS9 | |
| Polyclonal | |
| Rabbit | |
| metabolism | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 10170 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:LRRDMKAFGVHVSCIEPGLFKTNLADPVKVIEKKLAIWEQLSPDIKQQYGEGYIEKSLDKLKGN | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| dehydrogenase/reductase (SDR family) member 9,3alpha-HSD, EC 1.1, EC 1.1.1, EC 1.1.1.105, member 4,3-alpha-HSD, NADP-dependent retinol dehydrogenase/reductase, RDH15, RDH-E2, RDHL3ALPHA-HSD, RDHTBE | |
| DHRS9 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title