missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DNAH12 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
415.00 € - 572.00 €
Specifications
| Antigen | DNAH12 |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18400912
|
Novus Biologicals
NBP1-90586-25ul |
25 μL |
415.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18266188
|
Novus Biologicals
NBP1-90586 |
0.1 mL |
572.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
DNAH12 Polyclonal specifically detects DNAH12 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| DNAH12 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 201625 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:IHGLYLDGARWDRESGLLAEQYPKLLFDLMPIIWIKPTQKSRIIKSDAYVCP | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| axonemal beta dynein heavy chain 12, axonemal dynein heavy chain isotype3, axonemal, heavy polypeptide 12, ciliary dynein heavy chain 12, DHC3, DLP12, DNAH12L, DNAH7L, DNAHC12, DNAHC3, DNHD2, dynein heavy chain 12, axonemal, dynein heavy chain domain-containing protein 2, dynein, axonemal, heavy chain 12, dynein, heavy chain-5, FLJ40427, FLJ44290, HDHC3, HL19, HL-19 | |
| DNAH12 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title