missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DNAJC18 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
415.00 € - 624.00 €
Specifications
| Antigen | DNAJC18 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18205513
|
Novus Biologicals
NBP2-55723 |
100 μL |
624.00 €
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18658918
|
Novus Biologicals
NBP2-55723-25ul |
25 μL |
415.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
DNAJC18 Polyclonal specifically detects DNAJC18 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| DNAJC18 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| DnaJ (Hsp40) homolog, subfamily C, member 18, dnaJ homolog subfamily C member 18, MGC29463 | |
| DNAJC18 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 202052 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TPEELFNVFFGGHFPTGNIHMFSNVTDDTYYYRRRHRHERTQTQKEEEEEKPQTTYSA | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title