missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DNAJC5B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
280.00 € - 624.00 €
Specifications
| Antigen | DNAJC5B |
|---|---|
| Dilution | Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18638968
|
Novus Biologicals
NBP2-69037-25ul |
25 μL |
280.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18678198
|
Novus Biologicals
NBP2-69037 |
100 μg |
624.00 €
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
DNAJC5B Polyclonal antibody specifically detects DNAJC5B in Human samples. It is validated for Immunocytochemistry/ ImmunofluorescenceSpecifications
| DNAJC5B | |
| Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Human | |
| Beta cysteine string protein, Beta-CSP, CSP-beta, DnaJ (Hsp40) homolog, subfamily C, member 5 beta, dnaJ homolog subfamily C member 5B, dnaJ homolog subfamily C member X, MGC26226 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: MACNIPNQRQRTLSTTGEALYEILGLHKGASNEEIKKTYR | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol | |
| 85479 | |
| IgG | |
| Protein A purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title