missing translation for 'onlineSavingsMsg'
Learn More

DNAJC5G Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Novus Biologicals NBP2-38484-25ul

View more versions of this product

Product Code. 18670176

415.00 € / 25µL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

DNAJC5G Polyclonal specifically detects DNAJC5G in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen	DNAJC5G
Classification	Polyclonal
Dilution	Western Blot 0.4 μg/mL, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Accession No.	Q8N7S2
Gene Symbols	DNAJC5G
Immunogen	This antibody was developed against a recombinant protein corresponding to amino acids: NAAHAILSDSKKRKIYDQHGSLGIYLYDHFGEEGVRY
Quantity	25 μL
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage	Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.

Applications	Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias	CSP-gamma, DnaJ (Hsp40) homolog, subfamily C, member 5 gamma, dnaJ homolog subfamily C member 5G, FLJ40417, gamma cysteine string protein, gamma-CSP, Gamma-cysteine string protein
Host Species	Rabbit
Purification Method	Affinity Purified
Regulatory Status	RUO
Gene ID (Entrez)	285126
Target Species	Human
Isotype	IgG

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

DNAJC5G Antibody, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions