missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DPH3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-84276
This item is not returnable.
View return policy
Description
DPH3 Polyclonal specifically detects DPH3 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| DPH3 | |
| Polyclonal | |
| Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| DelGEF-interacting protein 1, DELGIP, DelGIP1, DELGIP1deafness locus putative guanine nucleotide exchange factor interacting protein1, DESR1CSL-type zinc finger-containing protein 2, DPH3 homolog, DPH3 homolog (KTI11, S. cerevisiae), DPH3, KTI11 homolog (S. cerevisiae), DPH3A, DPH3A, KTI11 homolog A, KTI11Del-GEF interacting protein, MGC20197, ZCSL2diphtheria toxin and Pseudomonas exotoxin A sensitivity required gene 1, zinc finger, CSL domain containing 2, zinc finger, CSL-type containing 2 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 285381 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| DPH3 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:EDFQYDEDSETYFYPCPCGDNFSITKEDLENGEDVATCPSCSLIIKVIYDKDQFVCGETVPAPSANKELVK | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction