missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Dynein light chain 2 cytoplasmic Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-92137-0.02ml
This item is not returnable.
View return policy
Description
Dynein light chain 2 cytoplasmic Polyclonal antibody specifically detects Dynein light chain 2 cytoplasmic in Mouse, Rat samples. It is validated for Western Blot
Specifications
| Dynein light chain 2 cytoplasmic | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| DLC2, DLC8b, DNCL1B, dynein light chain 2, cytoplasmic, Dynein light chain LC8-type 2,8 kDa dynein light chain b, dynein, light chain, LC8-type 2, MGC17810, radial spoke 22 homolog, RSPH22 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-89 of human DYNLL2 (NP_542408.1). MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG | |
| 0.02 mL | |
| Autophagy, Cell Biology, Cytoskeleton Markers, Signal Transduction | |
| 140735 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction