missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DYRK2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
369.00 € - 529.00 €
Specifications
| Antigen | DYRK2 |
|---|---|
| Dilution | Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml |
| Applications | Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18492821
|
Novus Biologicals
NBP1-89516-25ul |
25 μL |
369.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18255378
|
Novus Biologicals
NBP1-89516 |
0.1 mL |
529.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
DYRK2 Polyclonal specifically detects DYRK2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| DYRK2 | |
| Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| dual specificity tyrosine-phosphorylation-regulated kinase 2, dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2, EC 2.7.12, EC 2.7.12.1, FLJ21217, FLJ21365 | |
| DYRK2 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml | |
| Polyclonal | |
| Rabbit | |
| Apoptosis, Protein Kinase | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 8445 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:KQCLEWDPAVRMTPGQALRHPWLRRRLPKPPTGEKTSVKRITESTGAITSISKLPPPSSSASKLRTNLAQMTDANGNIQQRTVLP | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title