missing translation for 'onlineSavingsMsg'
Learn More

EEF1A2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Novus Biologicals NBP2-33983

View more versions of this product

Product Code. 18135235

559.00 € / 0.10mL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

EEF1A2 Polyclonal specifically detects EEF1A2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen	EEF1A2
Classification	Polyclonal
Dilution	Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Accession No.	Q05639
Gene Symbols	EEF1A2
Immunogen	This antibody was developed against a recombinant protein corresponding to amino acids: PGMVVTFAPVNITTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDIRR
Quantity	0.1 mL
Research Discipline	Cellular Signaling, Oncogenes, Transcription Factors and Regulators
Gene ID (Entrez)	1917
Target Species	Human
Isotype	IgG

Applications	Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias	eEF1A-2, EEF1ALFLJ41696, EF1A, EF-1-alpha-2, elongation factor 1-alpha 2, elongation factor-1 alpha, Eukaryotic elongation factor 1 A-2, eukaryotic translation elongation factor 1 alpha 2, HS1, statin, statin S1, statin-like, Statin-S1, STN, STNL
Host Species	Rabbit
Purification Method	Affinity Purified
Regulatory Status	RUO
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

EEF1A2 Antibody, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions