missing translation for 'onlineSavingsMsg'
Learn More
Learn More
EHF Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
280.00 € - 589.00 €
Specifications
| Antigen | EHF |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18698185
|
Novus Biologicals
NBP2-38896-25ul |
25 μL |
280.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18156888
|
Novus Biologicals
NBP2-38896 |
0.1 mL |
589.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
EHF Polyclonal specifically detects EHF in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| EHF | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| Q9NZC4 | |
| 26298 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: MILEGGGVMNLNPGNNLLHQPPAWTDSYSTCNVSSGFFGGQWHEIHPQYWTKYQVWEWLQHLLDTNQLDANCIPFQEFDINGEHL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| DNA replication Transcription Translation and Splicing | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| Epithelium-specific Ets transcription factor 3, ESE-3, ESE3 transcription factor, ESE3B, ESE3hEHF, ESEJepithelium-specific ets factor 3, ETS domain-containing transcription factor, ets homologous factor | |
| EHF | |
| IgG | |
| Affinity Purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title