missing translation for 'onlineSavingsMsg'
Learn More
Learn More
EIF3F Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-13952
This item is not returnable.
View return policy
Description
EIF3F Polyclonal antibody specifically detects EIF3F in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), KnockDown
Specifications
| EIF3F | |
| Polyclonal | |
| Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500, Knockdown Validated | |
| eIF3 p47, eIF-3-epsilon, eIF3-epsilon, eIF3f, eIF3-p47, EIF3S5eukaryotic translation initiation factor 3 subunit F, Eukaryotic translation initiation factor 3 subunit 5, eukaryotic translation initiation factor 3, subunit 5 (epsilon, 47kD), eukaryotic translation initiation factor 3, subunit 5 epsilon, 47kDa, eukaryotic translation initiation factor 3, subunit F | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: DSYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEVAVDMEFAKNMYELHKKVSPNELILGWYA | |
| 0.1 mL | |
| DNA replication Transcription Translation and Splicing | |
| 8665 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), KnockDown | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction