missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ELOVL5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
280.00 € - 589.00 €
Specifications
| Antigen | ELOVL5 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18458851
|
Novus Biologicals
NBP2-33500-25ul |
25 μL |
280.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18115242
|
Novus Biologicals
NBP2-33500 |
0.1 mL |
589.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ELOVL5 Polyclonal specifically detects ELOVL5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| ELOVL5 | |
| Polyclonal | |
| Rabbit | |
| Cardiovascular Biology, Cellular Signaling | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| dJ483K16.1, EC 2.3.1.n8, elongation of very long chain fatty acids protein 5, ELOVL family member 5, elongation of long chain fatty acids (FEN1/Elo2, ELOVL2,3-keto acyl-CoA synthase ELOVL5, Fatty acid elongase 1, hELO1, HELO1homolog of yeast long chain polyunsaturated fatty acid elongation enzyme 2, homolog of yeast long chain polyunsaturated fatty acid elongatio, SUR4/Elo3-like, yeast) | |
| ELOVL5 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| Q9NYP7 | |
| 60481 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: QTYNKKGASRRKDHLKDHQNGSMAAVNGHTNSFSPLENNVKPRKLRKD | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title