missing translation for 'onlineSavingsMsg'
Learn More
Learn More
EMC7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
433.00 € - 539.00 €
Specifications
| Antigen | EMC7 |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18415161
|
Novus Biologicals
NBP1-88547-25ul |
25 μL |
433.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18255916
|
Novus Biologicals
NBP1-88547 |
0.1 mL |
539.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
EMC7 Polyclonal specifically detects EMC7 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| EMC7 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 56851 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:DMRREMEQSMNMLNSNHELPDVSEFMTRLFSSKSSGKSSSGSSKTGKSGAGK | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| C11orf3, C15orf24, chromosome 15 hypothetical ATG/GTP binding protein, chromosome 15 open reading frame 24, ER membrane protein complex subunit 7, HT022, ORF1-FL1 | |
| EMC7 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title