missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Endoglin/CD105 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
302.00 € - 498.00 €
Specifications
| Antigen | Endoglin/CD105 |
|---|---|
| Dilution | Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18646138
|
Novus Biologicals
NBP2-49516-25ul |
25 μL |
302.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18631219
|
Novus Biologicals
NBP2-49516 |
0.1 mL |
498.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Endoglin/CD105 Polyclonal antibody specifically detects Endoglin/CD105 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| Endoglin/CD105 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cancer, Cell Biology, Cellular Markers, Endothelial Cell Markers, Extracellular Matrix, Hypoxia, Immunology, Mesenchymal Stem Cell Markers, Stem Cell Markers | |
| PBS (pH 7.2), 40% Glycerol | |
| 2022 | |
| IgG | |
| Immunogen affinity purified |
| Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| CD105, CD105 antigen, endoglin, ENDOsler-Rendu-Weber syndrome 1, HHT1FLJ41744, ORW, ORW1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: HILRVLPGHSAGPRTVTVKVELSCAPGDLDAVLILQGPPYVSWLIDANHNMQIWTTGEYSFKIFPEKNIRGFKLPDTPQGLLGEARMLNAS | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title