missing translation for 'onlineSavingsMsg'
Learn More
Learn More
EWSR1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
369.00 € - 593.00 €
Specifications
| Antigen | EWSR1 |
|---|---|
| Dilution | Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18601157
|
Novus Biologicals
NBP2-49380-25ul |
25 μL |
369.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18624828
|
Novus Biologicals
NBP2-49380 |
0.1 mL |
593.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
EWSR1 Polyclonal antibody specifically detects EWSR1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| EWSR1 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cancer, Cellular Markers, Neuroscience, Tumor Suppressors | |
| PBS (pH 7.2), 40% Glycerol | |
| 2130 | |
| IgG | |
| Immunogen affinity purified |
| Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| bK984G1.4, Ewing sarcoma breakpoint region 1, Ewing sarcoma breakpoint region 1 protein, Ewings sarcoma EWS-Fli1 (type 1) oncogene, EWS oncogene, EWSRNA-binding protein EWS | |
| This antibody was developed against a recombinant protein corresponding to amino acids: GDATVSYEDPPTAKAAVEWFDGKDFQGSKLKVSLARKKPPMNSMRGGLPPREGRGMPPPLRGGPG | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title