missing translation for 'onlineSavingsMsg'
Learn More
Learn More
EXOC2 Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
213.00 € - 507.00 €
Specifications
| Antigen | EXOC2 |
|---|---|
| Dilution | Western Blot 1:200 - 1:500, ELISA Recommended starting concentration is 1 μg/mL |
| Applications | ELISA, Western Blot |
| Classification | Monoclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30232128
|
Novus Biologicals
NBP3-33440-100ul |
100 μL |
507.00 €
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30228548
|
Novus Biologicals
NBP3-33440-20ul |
20 μL |
213.00 €
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
EXOC2 Monoclonal antibody specifically detects EXOC2 in Human,Mouse,Rat samples. It is validated for ELISA,Western BlotSpecifications
| EXOC2 | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Signal Transduction | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| 55770 | |
| IgG | |
| Affinity purified |
| Western Blot 1:200 - 1:500, ELISA Recommended starting concentration is 1 μg/mL | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| exocyst complex component 2, Exocyst complex component Sec5, FLJ11026, SEC5, SEC5L1, SEC5-like 1, SEC5-like 1 (S. cerevisiae), Sec5p | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human EXOC2 (NP_060773.3).,, Sequence:, MSRSRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGRGTSTVSFKLLKPEKIGI | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title