missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Fas Ligand/TNFSF6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
302.00 € - 511.00 €
Specifications
| Antigen | Fas Ligand/TNFSF6 |
|---|---|
| Dilution | Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18625448
|
Novus Biologicals
NBP2-49160-25ul |
25 μL |
302.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18626828
|
Novus Biologicals
NBP2-49160 |
0.1 mL |
511.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Fas Ligand/TNFSF6 Polyclonal antibody specifically detects Fas Ligand/TNFSF6 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| Fas Ligand/TNFSF6 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Adaptive Immunity, Apoptosis, Cancer, Diabetes Research, Immunology, Inhibitors Activators and Regulators | |
| PBS (pH 7.2), 40% Glycerol | |
| 356 | |
| IgG | |
| Immunogen affinity purified |
| Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| apoptosis (APO-1) antigen ligand 1, Apoptosis antigen ligand, APT1LG1CD95L, APTL, CD178, CD178 antigen, CD95-L, Fas antigen ligand, Fas ligand, Fas ligand (TNF superfamily, member 6), FASLCD95 ligand, TNFSF6FasL, tumor necrosis factor (ligand) superfamily, member 6, tumor necrosis factor ligand superfamily member 6 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: HTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFV | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title