missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FBXO41 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
415.00 € - 624.00 €
Especificaciones
| Antigen | FBXO41 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Código de producto | Marca | Quantity | Precio | Cantidad y disponibilidad | |||||
|---|---|---|---|---|---|---|---|---|---|
| Código de producto | Marca | Quantity | Precio | Cantidad y disponibilidad | |||||
|
18264392
|
Novus Biologicals
NBP2-58465 |
100 μL |
624.00 €
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18662059
|
Novus Biologicals
NBP2-58465-25ul |
25 μL |
415.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Descripción
FBXO41 Polyclonal specifically detects FBXO41 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Especificaciones
| FBXO41 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 150726 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ARREVFESTSFQGKEQAAGPSPAAPHLLHHHHHHAPLAHFPGDLVPASLPCEELAEPGLVPAAAARYALREIEIPLGELFARKSVAS | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| F-box only protein 41, F-box protein 41 | |
| FBXO41 | |
| IgG | |
| Affinity Purified |
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto