missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Ferroportin/SLC40A1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
369.00 € - 559.00 €
Specifications
| Antigen | Ferroportin/SLC40A1 |
|---|---|
| Dilution | Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Applications | Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18609177
|
Novus Biologicals
NBP2-49454-25ul |
25 μL |
369.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18605228
|
Novus Biologicals
NBP2-49454 |
0.1 mL |
559.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Ferroportin/SLC40A1 Polyclonal antibody specifically detects Ferroportin/SLC40A1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)Specifications
| Ferroportin/SLC40A1 | |
| Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cancer, Lipid and Metabolism, Signal Transduction | |
| PBS (pH 7.2), 40% Glycerol | |
| 30061 | |
| IgG | |
| Immunogen affinity purified |
| Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| Ferroportin-1, FPN1, FPN1IREG1ferroportin 1, HFE4, HFE4ferroportin-1, IREG1, iron regulated gene 1, Iron-regulated transporter 1, member 3, MST079, MSTP079, MTP1, putative ferroportin 1 variant IIIB, SLC11A3, SLC11A3iron regulated gene 1, solute carrier family 11 (proton-coupled divalent metal ion transporters), solute carrier family 11 (proton-coupled divalent metal ion transporters), member 3, solute carrier family 40 (iron-regulated transporter), member 1, solute carrier family 40 member 1 | |
| This Ferroportin/SLC40A1 Antibody was developed against a recombinant protein corresponding to amino acids: VKAGLKEEETELKQLNLHKDTEPKPLEGTHLMGVKDSNIHELEHEQEPTCASQMAEPFRTFRDGWVSYYN | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title