missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FHIT Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
Brand: Novus Biologicals NBP1-89061-25ul
Denna artikel kan inte returneras.
Se returpolicy
Beskrivning
FHIT Polyclonal specifically detects FHIT in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifikationer
| FHIT | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| AP3A hydrolase, AP3AaseFRA3Bbis(5'-adenosyl)-triphosphatase, Diadenosine 5'-5'''-P1, dinucleosidetriphosphatase, EC 3.6.1.29, fragile histidine triad gene, Fragile histidine triad protein, P3-triphosphate hydrolase, tumor suppressor protein | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| FHIT | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:GTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEA | |
| 25 μL | |
| Apoptosis, Cancer, Cellular Markers, Lipid and Metabolism, Tumor Suppressors | |
| 2272 | |
| Human | |
| IgG |
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel
For Research Use Only
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering