missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FNBP3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-87933
This item is not returnable.
View return policy
Description
FNBP3 Polyclonal specifically detects FNBP3 in Human samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| FNBP3 | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Simple Western 1:20, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| O75400 | |
| PRPF40A | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:NASTSASNTVSGTVPVVPEPEVTSIVATVVDNENTVTISTEEQAQLTSTPAIQDQSVEVSSNTGEETSKQETVADFTP | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| Fas ligand-associated factor 1, Fas-ligand associated factor 1, FBP-11, FBP11Formin-binding protein 11, FLAF1Renal carcinoma antigen NY-REN-6, FLJ20585, FNBP3Huntingtin-interacting protein A, formin binding protein 3, Formin-binding protein 3Huntingtin-interacting protein 10, HIP10HIP-10, HYPAHuntingtin yeast partner A, NY-REN-6, NY-REN-6 antigen, pre-mRNA-processing factor 40 homolog A, Prp40, PRP40 pre-mRNA processing factor 40 homolog A (S. cerevisiae), PRP40 pre-mRNA processing factor 40 homolog A (yeast) | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 55660 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction