missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FOPNL Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
292.00 € - 624.00 €
Spezifikation
| Antigen | FOPNL |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Produktcode | Marke | Quantity | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Quantity | Preis | Menge & Verfügbarkeit | |||||
|
18490361
|
Novus Biologicals
NBP1-84109-25ul |
25 μL |
292.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18260278
|
Novus Biologicals
NBP1-84109 |
0.1 mL |
624.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Beschreibung
FOPNL Polyclonal specifically detects FOPNL in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Spezifikation
| FOPNL | |
| Polyclonal | |
| Rabbit | |
| Human | |
| C16orf63, chromosome 16 open reading frame 63, DKFZp686N1651, FGFR1OP N-terminal like, FGFR1OP N-terminal-like protein, FLJ31153, FOP-related protein of 20 kDa, FOR20, lisH domain-containing protein C16orf63, PHSECRG2pluripotent embryonic stem cell-related protein | |
| FOPNL | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 123811 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:IHELNAFEESKDNTIPLLYGILAHFLRGTKDGIQNAFLKGPSLQPSDPSLGRQPSRRKPMDDHLRKEEQKSTNIEDLHVSQ | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts